IP Address Inspector

ATTENTION

This IP has not seen any suspicious activity within the last 3 months. This IP is most likely clean and trustworthy now. (This record will remain public for historical purposes, however.)

131.91.129.161

The Project Honey Pot system has detected behavior from the IP address consistent with that of a comment spammer. Below we've reported some other data associated with this IP. This interrelated data helps map spammers' networks and aids in law enforcement efforts. If you know something about this IP, please leave a comment.

Geographic Location	United States
Spider First Seen	approximately 12 years, 8 months, 1 week ago
Spider Last Seen	within 12 years, 7 months, 3 weeks
Spider Sightings	24 visit(s)
User-Agents	seen with 11 user-agent(s)

First Post On	approximately 12 years, 7 months, 4 weeks ago
Last Post On	within 12 years, 7 months, 3 weeks
Form Posts	10 web post submission(s) sent from this IP

IPs In The Neighborhood
131.91.129.24 \| S
131.91.129.50 \| S
131.91.129.51
131.91.129.219
131.91.130.41

Sample Spam URLs & Keywords Posted From 131.91.129.161

Domain: gvalxznkanss.com
URL: http://gvalxznkanss.com/
Keywords: gvalxznkanss

Domain: llocrkykrhkd.com
URL: http://llocrkykrhkd.com/
Keywords: llocrkykrhkd

Domain: moaejrczhhga.com
URL: http://moaejrczhhga.com/
Keywords: llocrkykrhkd

Domain: www.metroflog.com
URL: http://www.metroflog.com/uabukudas/profile
Keywords: nn models young

Domain: www.metroflog.com
URL: http://www.metroflog.com/odehegygy/profile
Keywords: nn preteen girls

Domain: www.metroflog.com
URL: http://www.metroflog.com/iogefi/profile
Keywords: nn lolita pics

Domain: www.metroflog.com
URL: http://www.metroflog.com/itoarofej/profile
Keywords: nn lollita

Domain: www.metroflog.com
URL: http://www.metroflog.com/bytaitio/profile
Keywords: skinny and nn models

Domain: www.metroflog.com
URL: http://www.metroflog.com/ynuihyhy/profile
Keywords: nn models galleries

Domain: www.metroflog.com
URL: http://www.metroflog.com/uutyupuk/profile
Keywords: very young nn

Domain: www.metroflog.com
URL: http://www.metroflog.com/lijihulym/profile
Keywords: nn skinny and shaved

Domain: www.metroflog.com
URL: http://www.metroflog.com/ufebodopu/profile
Keywords: nn model sierra

Domain: www.metroflog.com
URL: http://www.metroflog.com/eqiyyban/profile
Keywords: nn lolita bbs

Domain: nudehouse.treeauts.eu
URL: http://nudehouse.treeauts.eu/
Keywords: nude house

Domain: natellepreferprenatalvitamins.takecrutex.info
URL: http://natellepreferprenatalvitamins.takecrutex.info/
Keywords: natelle prefer prenatal vitamins

131.91.129.161's User Agent Strings

Mozilla/4.0 (compatible; MSIE 4.0; MSN 2.6; Windows 95; Gateway2000)

Mozilla/4.0 (compatible; MSIE 4.0; Windows 95)

Mozilla/4.0 (compatible; MSIE 5.01; Windows 95)

Mozilla/4.0 (compatible; MSIE 5.01; Windows 95; USA On-Site)

Mozilla/4.0 (compatible; MSIE 5.01; Windows 98; QXW0332q)

Mozilla/4.0 (compatible; MSIE 6.0; Windows NT 5.1; SV1)

Mozilla/5.0 (Windows NT 5.1; U; en) Opera 8.01

Mozilla/5.0 (Windows; U; Windows NT 5.0; en-US; rv:0.9.7) Gecko/20011221

Mozilla/5.0 (Windows; U; Windows NT 5.0; en-US; rv:1.0rc2) Gecko/20020510

Mozilla/5.0 (Windows; U; Windows NT 5.1; en-US; rv:1.9.0.10) Gecko/2009042316 Firefox/3.0.10

Mozilla/5.0 (Windows; U; Windows NT 5.1; en-US; rv:1.9.0.5) Gecko/2008120122 Firefox/3.0.5

0 comment(s) - Comment on this IP

Page generated on: April 25 2024 07:56:15 PM

Please note: being listed on these pages does not necessarily mean an IP address, domain name, or any other information is owned by a spammer. For example, it may have been hijacked from its true owner and used by a spammer.

Want to keep this IP address off your website? Start taking advantage of http:BL.

If you are the owner of this IP address, you can whitelist it by connecting to this page from the IP itself (or from an IP within /24). Alternatively, the IP will be auto excused after 90 days of no activity.

131.91.129.161 | C

Advertisements displayed on this page are not necessarily endorsed by Project Honey Pot